PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10011559
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family GRF
Protein Properties Length: 497aa    MW: 52555.9 Da    PI: 7.9806
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10011559genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC76.92e-24169213145
          WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                  d+epgrCrRtDGKkWRCsr++++++k+CErH++rgr+rsrk++e 
  Lus10011559 169 DPEPGRCRRTDGKKWRCSRDAVADQKYCERHINRGRHRSRKPVEG 213
                  79****************************************985 PP

2QLQ56.67.7e-2097133137
          QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                  ++FT++Q+++L++Q+l+yKy+ an+ vP++Ll +++k
  Lus10011559  97 GPFTPSQWMELEHQALIYKYITANVAVPSNLLNPLKK 133
                  59******************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009515.8E-1197133IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088803.8E-1498131IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.44698133IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.287169213IPR014977WRC domain
PfamPF088796.0E-21170212IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009624Biological Processresponse to nematode
GO:0048364Biological Processroot development
GO:0048366Biological Processleaf development
GO:0061062Biological Processregulation of nematode larval development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 497 aa     Download sequence    Send to blast
MDFGVLGSQQ SPSILHPPDS NQNAISTLGS DAACCKPSKI PRTSSTMPHA SGLLRSNSTS  60
NMLSFSNSAP YHHYPPSPGS LSATMHGAAA AFTGFRGPFT PSQWMELEHQ ALIYKYITAN  120
VAVPSNLLNP LKKSLYPFAL SSSSSAASFI PGSLGWGAFH LGYPGSTNDP EPGRCRRTDG  180
KKWRCSRDAV ADQKYCERHI NRGRHRSRKP VEGQSGHGVS GTKVVQQLAT STSAITTNSA  240
AAASCIGISS QQQQQQQLKD LQLQHQHANA SRFSVSKVNA SSLMSVPKQN VQIEESHCHS  300
EFGLVSYDSL LNPSQQGSTT SCYNTSFLSF SDQDTQDQHS LHQFMDNDWQ HKDGQSTRNV  360
ISWPEELKSD WTQLSMSIPM APSDFSSSSS SPAHEKLALS PWGGGGGGGA SMGGGPLGEV  420
LTTSASANAG CWDGSSPPQL GFSPTGVLQK ATFASQSNSS TGSSPRGGDH SKRNSLCDDV  480
LGSNIVSSST TALPSL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ8861691e-117HQ886169.1 Linum usitatissimum clone Contig2117 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006466427.11e-133PREDICTED: growth-regulating factor 1
TrEMBLA0A067GGN01e-132A0A067GGN0_CITSI; Uncharacterized protein
STRINGPOPTR_0014s00780.11e-128(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20853481
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22840.17e-82growth-regulating factor 1